FLAP (ALOX5AP) (NM_001629) Human Recombinant Protein

FLAP protein,

Recombinant protein of human arachidonate 5-lipoxygenase-activating protein (ALOX5AP)

Product Info Summary

SKU: PROTP20292
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

FLAP (ALOX5AP) (NM_001629) Human Recombinant Protein

View all FLAP recombinant proteins

SKU/Catalog Number

PROTP20292

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human arachidonate 5-lipoxygenase-activating protein (ALOX5AP)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

FLAP (ALOX5AP) (NM_001629) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP20292)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

18 kDa

Amino Acid Sequence

MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP

Validation Images & Assay Conditions

Gene/Protein Information For ALOX5AP (Source: Uniprot.org, NCBI)

Gene Name

ALOX5AP

Full Name

Arachidonate 5-lipoxygenase-activating protein

Weight

18 kDa

Superfamily

MAPEG family

Alternative Names

arachidonate 5-lipoxygenase-activating protein; FLAPMK-886-binding protein ALOX5AP FLAP arachidonate 5-lipoxygenase activating protein arachidonate 5-lipoxygenase-activating protein|MK-886-binding protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ALOX5AP, check out the ALOX5AP Infographic

ALOX5AP infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ALOX5AP: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP20292

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used FLAP (ALOX5AP) (NM_001629) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For FLAP (ALOX5AP) (NM_001629) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for FLAP (ALOX5AP) (NM_001629) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP20292
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.