FGF1 (NM_000800) Human Recombinant Protein

FGF acidic/FGF1 protein,

Product Info Summary

SKU: PROTP05230
Size: 20 µg
Source: HEK293T

Product Name

FGF1 (NM_000800) Human Recombinant Protein

View all FGF acidic/FGF1 recombinant proteins

SKU/Catalog Number

PROTP05230

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human fibroblast growth factor 1 (acidic) (FGF1), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

FGF1 (NM_000800) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP05230)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

17.3 kDa

Amino Acid Sequence

MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Validation Images & Assay Conditions

Gene/Protein Information For FGF1 (Source: Uniprot.org, NCBI)

Gene Name

FGF1

Full Name

Fibroblast growth factor 1

Weight

17.3 kDa

Superfamily

heparin-binding growth factors family

Alternative Names

AFGF; alpha; alpha-ECGF; beta-ECGF; ECGF; ECGFB; ECGF-betaAcidic fibroblast growth factor; endothelial cell growth factor, beta; FGF acidic; FGF-1; FGFABeta-endothelial cell growth factor; FGF-alpha; fibroblast growth factor 1 (acidic); GLIO703; HBGF1; HBGF-1; heparin-binding growth factor 1 FGF1 AFGF, ECGF, ECGF-beta, ECGFA, ECGFB, FGF-1, FGF-alpha, FGFA, GLIO703, HBGF-1, HBGF1 fibroblast growth factor 1 fibroblast growth factor 1|beta-endothelial cell growth factor|endothelial cell growth factor, alpha|endothelial cell growth factor, beta|fibroblast growth factor 1 (acidic)|heparin-binding growth factor 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on FGF1, check out the FGF1 Infographic

FGF1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for FGF1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP05230

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used FGF1 (NM_000800) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For FGF1 (NM_000800) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for FGF1 (NM_000800) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP05230
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.