FANK1 (NM_145235) Human Recombinant Protein

Fank1 protein,

Product Info Summary

SKU: PROTQ8TC84
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

FANK1 (NM_145235) Human Recombinant Protein

View all Fank1 recombinant proteins

SKU/Catalog Number

PROTQ8TC84

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human fibronectin type III and ankyrin repeat domains 1 (FANK1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

FANK1 (NM_145235) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8TC84)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

38.2 kDa

Amino Acid Sequence

MEPQRIMPPSKPHPPVVGKVTHHSIELYWDLEKKAKRQGPQEQWFRFSIEEEDPKMHTYGIIYTGYATKHVVEGLEPRTLYRFRLKVTSPSGECEYSPLVSVSTTREPISSEHLHRAVSVNDEDLLVRILQGGRVKVDVPNKFGFTALMVAAQKGYTRLVKILVSNGTDVNLKNGSGKDSLMLACYAGHLDVVKYLRRHGASWQARDLGGCTALHWAADGGHCSVIEWMIKDGCEVDVVDTGSGWTPLMRVSAVSGNQRVASLLIDAGANVNVKDRNGKTPLMVAVLNNHEELVQLLLDKGADASVKNEFGKGVLEMARVFDRQSVVSLLEERKKKQRPKKSCVC

Validation Images & Assay Conditions

Gene/Protein Information For FANK1 (Source: Uniprot.org, NCBI)

Gene Name

FANK1

Full Name

Fibronectin type 3 and ankyrin repeat domains 1 protein

Weight

38.2 kDa

Alternative Names

1700007B22Rik; fibronectin type 3 and ankyrin repeat domains 1; fibronectin type 3 and ankyrin repeat domains protein 1; fibronectin type III and ankyrin repeat domains 1 Fank1|1700007B22Rik, AI850911, FANK1S|fibronectin type 3 and ankyrin repeat domains 1|fibronectin type 3 and ankyrin repeat domains 1 protein|GSG1|germ cell-specific 1|germ cell-specific gene 1 protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on FANK1, check out the FANK1 Infographic

FANK1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for FANK1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8TC84

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used FANK1 (NM_145235) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For FANK1 (NM_145235) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for FANK1 (NM_145235) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8TC84
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.