FAM86C1 (NM_152563) Human Recombinant Protein

FAM86C1 protein,

Recombinant protein of human family with sequence similarity 86, member C (FAM86C), transcript variant 2

Product Info Summary

SKU: PROTQ9NVL1
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

FAM86C1 (NM_152563) Human Recombinant Protein

View all FAM86C1 recombinant proteins

SKU/Catalog Number

PROTQ9NVL1

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human family with sequence similarity 86, member C (FAM86C), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

FAM86C1 (NM_152563) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NVL1)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

14.4 kDa

Amino Acid Sequence

MAPEENAGSELLLQSFKRRFLAARALRSFRWQSLEAKLRDSSDSELLRDILQKTCCIAQKPSCRWSGSCGGWLPAGSTSGLLNSTWPLPSATQRCASCSPPSYAGLGSDGKRKLIMTRNCFPTESTWRWQS

Validation Images & Assay Conditions

Gene/Protein Information For FAM86C1 (Source: Uniprot.org, NCBI)

Gene Name

FAM86C1

Full Name

Protein FAM86C1

Weight

14.4 kDa

Superfamily

class I-like SAM-binding methyltransferase superfamily

Alternative Names

Protein FAM86C1 FAM86C1P FAM86C, FAM86C1 family with sequence similarity 86 member C1, pseudogene family with sequence similarity 86, member C|protein FAM86C1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on FAM86C1, check out the FAM86C1 Infographic

FAM86C1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for FAM86C1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9NVL1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used FAM86C1 (NM_152563) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For FAM86C1 (NM_152563) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for FAM86C1 (NM_152563) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NVL1
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.