FAM76A (NM_152660) Human Recombinant Protein

FAM76A protein,

Recombinant protein of human family with sequence similarity 76, member A (FAM76A), transcript variant 3

Product Info Summary

SKU: PROTQ8TAV0
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

FAM76A (NM_152660) Human Recombinant Protein

View all FAM76A recombinant proteins

SKU/Catalog Number

PROTQ8TAV0

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human family with sequence similarity 76, member A (FAM76A), transcript variant 3

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

FAM76A (NM_152660) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8TAV0)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

34.9 kDa

Amino Acid Sequence

MAALYACTKCHQRFPFEALSQGQQLCKECRIAHPVVKCTYCRTEYQQESKTNTICKKCAQNVQLYGTPKPCQYCNIIAAFIGNKCQRCTNSEKKYGPPYSCEQCKQQCAFDRKDDRKKVDGKLLCWLCTLSYKRVLQKTKEQRKHLSSSSRAGHQEKEQYSRLSGGGHYNSQKTLSTSSIQNEIPKKKSKFESITTNGDSFSPDLALDSPGTDHFVIIAQLKEEVATLKKMLHQKDQMILEKEKKITELKADFQYQESQMRAKMNQMEKTHKEVTEQLQAKNRELLKQAAALSKSKKSEKSGAITSP

Validation Images & Assay Conditions

Gene/Protein Information For FAM76A (Source: Uniprot.org, NCBI)

Gene Name

FAM76A

Full Name

Protein FAM76A

Weight

34.9 kDa

Superfamily

FAM76 family

Alternative Names

family with sequence similarity 76, member A; FLJ41946; hypothetical protein LOC199870; MGC34648 FAM76A family with sequence similarity 76 member A protein FAM76A

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on FAM76A, check out the FAM76A Infographic

FAM76A infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for FAM76A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8TAV0

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used FAM76A (NM_152660) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For FAM76A (NM_152660) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for FAM76A (NM_152660) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8TAV0
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.