FAM3C (NM_014888) Human Recombinant Protein

FAM3C protein,

Product Info Summary

SKU: PROTQ92520
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

FAM3C (NM_014888) Human Recombinant Protein

View all FAM3C recombinant proteins

SKU/Catalog Number

PROTQ92520

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human family with sequence similarity 3, member C (FAM3C), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

FAM3C (NM_014888) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ92520)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

22.1 kDa

Amino Acid Sequence

MRVAGAAKLVVAVAVFLLTFYVISQVFEIKMDASLGNLFARSALDTAARSTKPPRYKCGISKACPEKHFAFKMASGAANVVGPKICLEDNVLMSGVKNNVGRGINVALANGKTGEVLDTKYFDMWGGDVAPFIEFLKAIQDGTIVLMGTYDDGATKLNDEARRLIADLGSTSITNLGFRDNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD

Validation Images & Assay Conditions

Gene/Protein Information For FAM3C (Source: Uniprot.org, NCBI)

Gene Name

FAM3C

Full Name

Protein FAM3C

Weight

22.1 kDa

Superfamily

FAM3 family

Alternative Names

D6WSU176e; FAM3C; family with sequence similarity 3, member C; GS3876; ILEI; ILEIInterleukin-like EMT inducer; predicted osteoblast protein FAM3C GS3786, ILEI FAM3 metabolism regulating signaling molecule C protein FAM3C|family with sequence similarity 3 member C|interleukin-like EMT inducer|interleukin-like epithelial-mesenchymal transition inducer|predicted osteoblast protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on FAM3C, check out the FAM3C Infographic

FAM3C infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for FAM3C: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ92520

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used FAM3C (NM_014888) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For FAM3C (NM_014888) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for FAM3C (NM_014888) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ92520
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.