FAM3B (NM_058186) Human Recombinant Protein

Fam3b protein,

Product Info Summary

SKU: PROTP58499
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

FAM3B (NM_058186) Human Recombinant Protein

View all Fam3b recombinant proteins

SKU/Catalog Number

PROTP58499

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human family with sequence similarity 3, member B (FAM3B), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

FAM3B (NM_058186) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP58499)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

25.8 kDa

Amino Acid Sequence

MRPLAGGLLKVVFVVFASLCAWYSGYLLAELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS

Validation Images & Assay Conditions

Gene/Protein Information For Fam3b (Source: Uniprot.org, NCBI)

Gene Name

Fam3b

Full Name

Protein FAM3B

Weight

25.8 kDa

Superfamily

FAM3 family

Alternative Names

2-21; C21orf11; C21orf76PANDER; chromosome 21 open reading frame 11; Cytokine-like protein 2-21; D21M16SJHU19e; FAM3B; family with sequence similarity 3, member B; ORF9; pancreatic derived factor; Pancreatic-derived factor; PANDER; PRED44 Fam3b|2-21, 9030624C24Rik, D16Jhu19e, ORF9, Pa, Pander|FAM3 metabolism regulating signaling molecule B|protein FAM3B|cytokine-like protein 2-21|family with sequence similarity 3, member B|pancreatic-derived factor

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on Fam3b, check out the Fam3b Infographic

Fam3b infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Fam3b: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP58499

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used FAM3B (NM_058186) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For FAM3B (NM_058186) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for FAM3B (NM_058186) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP58499
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.