FAM36A (COX20) (NM_198076) Human Recombinant Protein

FAM36A protein,

Recombinant protein of human family with sequence similarity 36, member A (FAM36A)

Product Info Summary

SKU: PROTQ5RI15
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

FAM36A (COX20) (NM_198076) Human Recombinant Protein

View all FAM36A recombinant proteins

SKU/Catalog Number

PROTQ5RI15

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human family with sequence similarity 36, member A (FAM36A)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

FAM36A (COX20) (NM_198076) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ5RI15)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

13.1 kDa

Amino Acid Sequence

MAAPPEPGEPEERKSLKLLGFLDVENTPCARHSILYGSLGSVVAGFGHFLFTSRIRRSCDVGVGGFILVTLGCWFHCRYNYAKQRIQERIAREEIKKKILYEGTHLDPERKHNGSSSN

Validation Images & Assay Conditions

Gene/Protein Information For COX20 (Source: Uniprot.org, NCBI)

Gene Name

COX20

Full Name

Cytochrome c oxidase assembly protein COX20, mitochondrial

Weight

13.1 kDa

Superfamily

COX20 family

Alternative Names

family with sequence similarity 36, member A; FLJ43269

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on COX20, check out the COX20 Infographic

COX20 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for COX20: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ5RI15

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used FAM36A (COX20) (NM_198076) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For FAM36A (COX20) (NM_198076) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for FAM36A (COX20) (NM_198076) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ5RI15
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.