FABP6 (NM_001445) Human Recombinant Protein

FABP6 protein,

Product Info Summary

SKU: PROTP51161
Size: 20 µg
Source: HEK293T

Product Name

FABP6 (NM_001445) Human Recombinant Protein

View all FABP6 recombinant proteins

SKU/Catalog Number

PROTP51161

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human fatty acid binding protein 6, ileal (FABP6), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

FABP6 (NM_001445) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP51161)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

14.2 kDa

Amino Acid Sequence

MAFTGKFEMESEKNYDEFMKLLGISSDVIEKAHNFKIVTEVQQDGQDFTWSQHYYGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA

Validation Images & Assay Conditions

Gene/Protein Information For FABP6 (Source: Uniprot.org, NCBI)

Gene Name

FABP6

Full Name

Gastrotropin

Weight

14.2 kDa

Superfamily

calycin superfamily

Alternative Names

FABP6; fatty acid binding protein 6, ileal; Fatty acid-binding protein 6; Gastrotropin; I-15P; I-15PIntestinal 15 kDa protein; IBABP; I-BABPIntestinal bile acid-binding protein; I-BALB; I-BAP; ILBP; ILBP3; ILBPGT; ileal bile acid binding protein; ILLBP; ILLBPIleal lipid-binding protein; illeal lipid-binding protein FABP6 I-15P, I-BABP, I-BALB, I-BAP, ILBP, ILBP3, ILLBP fatty acid binding protein 6 gastrotropin|GT|fatty acid binding protein 6, ileal|ileal bile acid binding protein|ileal lipid-binding protein|illeal lipid-binding protein|intestinal 15 kDa protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on FABP6, check out the FABP6 Infographic

FABP6 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for FABP6: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP51161

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used FABP6 (NM_001445) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For FABP6 (NM_001445) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for FABP6 (NM_001445) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP51161
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.