F115A (TCAF1) (NM_014719) Human Recombinant Protein

TCAF1 protein,

Recombinant protein of human family with sequence similarity 115, member A (FAM115A)

Product Info Summary

SKU: PROTQ9Y4C2
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

F115A (TCAF1) (NM_014719) Human Recombinant Protein

View all TCAF1 recombinant proteins

SKU/Catalog Number

PROTQ9Y4C2

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human family with sequence similarity 115, member A (FAM115A)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

F115A (TCAF1) (NM_014719) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y4C2)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

102 kDa

Amino Acid Sequence

MATPSAAFEALMNGVTSWDVPEDAVPCELLLIGEASFPVMVNDMGQVLIAASSYGRGRLVVVSHEDYLVEAQLTPFLLNAVGWLCSSPGAPIGVHPSLAPLAKILEGSGVDAKVEPEVKDSLGVYCIDAYNETMTEKLVKFMKCGGGLLIGGQAWDWANQGEDERVLFTFPGNLVTSVAGIYFTDNKGDTSFFKVSKKMPKIPVLVSCEDDLSDDREELLHGISELDISNSDCFPSQLLVHGALAFPLGLDSYHGCVIAAARYGRGRVVVTGHKVLFTVGKLGPFLLNAVRWLDGGRRGKIVVQTELRTLSGLLAVGGIDTSIEPNLTSDASVYCFEPVSEVGVKELQEFVAEGGGLFVGAQAWWWAFKNPGVSPLARFPGNLLLNPFGISITSQSLNPGPFRTPKAGIRTYHFRSTLAEFQVIMGRKRGNVEKGWLAKLGPDGAAFLQIPAEEIPAYMSVHRLLRKLLSRYRLPVATRENPVINDCCRGAMLSLATGLAHSGSDLSLLVPEIEDMYSSPYLRPSESPITVEVNCTNPGTRYCWMSTGLYIPGRQIIEVSLPEAAASADLKIQIGCHTDDLTRASKLFRGPLVINRCCLDKPTKSITCLWGGLLYIIVPQNSKLGSVPVTVKGAVHAPYYKLGETTLEEWKRRIQENPGPWGELATDNIILTVPTANLRTLENPEPLLRLWDEVMQAVARLGAEPFPLRLPQRIVADVQISVGWMHAGYPIMCHLESVQELINEKLIRTKGLWGPVHELGRNQQRQEWEFPPHTTEATCNLWCVYVHETVLGIPRSRANIALWPPVREKRVRIYLSKGPNVKNWNAWTALETYLQLQEAFGWEPFIRLFTEYRNQTNLPTENVDKMNLWVKMFSHQVQKNLAPFFEAWAWPIQKEVATSLAYLPEWKENIMKLYLLTQMPH

Validation Images & Assay Conditions

Gene/Protein Information For TCAF1 (Source: Uniprot.org, NCBI)

Gene Name

TCAF1

Full Name

TRPM8 channel-associated factor 1

Weight

102 kDa

Superfamily

TCAF family

Alternative Names

TRPM8 channel-associated factor 1 TCAF1 FAM115A TRPM8 channel associated factor 1 TRPM8 channel-associated factor 1|TRP channel-associated factor 1|family with sequence similarity 115, member A|protein FAM115A

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TCAF1, check out the TCAF1 Infographic

TCAF1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TCAF1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9Y4C2

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used F115A (TCAF1) (NM_014719) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For F115A (TCAF1) (NM_014719) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for F115A (TCAF1) (NM_014719) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y4C2
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.