EVPLL (NM_001145127) Human Recombinant Protein

EVPLL protein,

Recombinant protein of human envoplakin-like (EVPLL)

Product Info Summary

SKU: PROTA8MZ36
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

EVPLL (NM_001145127) Human Recombinant Protein

View all EVPLL recombinant proteins

SKU/Catalog Number

PROTA8MZ36

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human envoplakin-like (EVPLL)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

EVPLL (NM_001145127) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTA8MZ36)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

33.8 kDa

Amino Acid Sequence

MQASADQVERDILETQKRLQQDRLNSEQSQALQHQQETGSSLKEAEVLLKDLFLDVDKARRLKHPQAEETEKDIEQLHERVTQECAEYCALYEKMVLPPRRGIQGRLGTRAGAETEAGLRRPVWAGHGGAGGTDRGAQHRAEGDQRPRRAAAEPGGAGCRHHPEPIPRPTEGGVVARAEPGQPVHALQGCTWQLSALAEQQRRILQQDWSDLMADPAGVRREYEHFKQHELLSQEQSVNQLEEDGKRMVELRHPAVGPIQAHQEALKMEWQNFLNLCICQETQLQHVEDYSRILCPSSSPH

Validation Images & Assay Conditions

Gene/Protein Information For EVPLL (Source: Uniprot.org, NCBI)

Gene Name

EVPLL

Full Name

Envoplakin-like protein

Weight

33.8 kDa

Superfamily

plakin or cytolinker family

Alternative Names

Envoplakin-like protein EVPLL envoplakin like envoplakin-like protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on EVPLL, check out the EVPLL Infographic

EVPLL infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for EVPLL: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTA8MZ36

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used EVPLL (NM_001145127) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For EVPLL (NM_001145127) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for EVPLL (NM_001145127) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTA8MZ36
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.