Estrogen Related Receptor gamma (ESRRG) (NM_206594) Human Recombinant Protein

ERR gamma/NR3B3 protein,

Recombinant protein of human estrogen-related receptor gamma (ESRRG), transcript variant 2

Product Info Summary

SKU: PROTP62508
Size: 20 µg
Source: HEK293T

Product Name

Estrogen Related Receptor gamma (ESRRG) (NM_206594) Human Recombinant Protein

View all ERR gamma/NR3B3 recombinant proteins

SKU/Catalog Number

PROTP62508

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human estrogen-related receptor gamma (ESRRG), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Estrogen Related Receptor gamma (ESRRG) (NM_206594) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP62508)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

48.4 kDa

Amino Acid Sequence

MSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV

Validation Images & Assay Conditions

There are currently no images for this product. We are working on uploading them please check back shortly or contact us to expedite our upload process for this antibody.

Gene/Protein Information For ESRRG (Source: Uniprot.org, NCBI)

Gene Name

ESRRG

Full Name

Estrogen-related receptor gamma

Weight

48.4 kDa

Superfamily

nuclear hormone receptor family

Alternative Names

DKFZp781L1617; ERR gamma; ERR gamma-2; ERR3; ERRG2; ERRgamma; ESRRG; Estrogen receptor-related protein 3; estrogen-related receptor gamma; FLJ16023; KIAA0832; NR3B3; Nuclear receptor subfamily 3 group B member 3 ESRRG ERR-gamma, ERR3, ERRg, ERRgamma, NR3B3 estrogen related receptor gamma estrogen-related receptor gamma|ERR gamma-2|estrogen receptor-related protein 3|nuclear receptor subfamily 3 group B member 3

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ESRRG, check out the ESRRG Infographic

ESRRG infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ESRRG: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP62508

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Estrogen Related Receptor gamma (ESRRG) (NM_206594) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Estrogen Related Receptor gamma (ESRRG) (NM_206594) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Estrogen Related Receptor gamma (ESRRG) (NM_206594) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP62508
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.