ERG28 (C14orf1) (NM_007176) Human Recombinant Protein

ERG28 protein,

Recombinant protein of human chromosome 14 open reading frame 1 (C14orf1)

Product Info Summary

SKU: PROTQ9UKR5
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

ERG28 (C14orf1) (NM_007176) Human Recombinant Protein

View all ERG28 recombinant proteins

SKU/Catalog Number

PROTQ9UKR5

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chromosome 14 open reading frame 1 (C14orf1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

ERG28 (C14orf1) (NM_007176) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9UKR5)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

15.7 kDa

Amino Acid Sequence

MSRFLNVLRSWLVMVSIIAMGNTLQSFRDHTFLYEKLYTGKPNLVNGLQARTFGIWTLLSSVIRCLCAIDIHNKTLYHITLWTFLLALGHFLSELFVYGTAAPTIGVLAPLMVASFSILGMLVGLRYLEVEPVSRQKKRN

Validation Images & Assay Conditions

Gene/Protein Information For ERG28 (Source: Uniprot.org, NCBI)

Gene Name

ERG28

Full Name

Ergosterol biosynthetic protein 28 homolog

Weight

15.7 kDa

Superfamily

ERG28 family

Alternative Names

Ergosterol biosynthetic protein 28 homolog ERG28 C14orf1, NET51 ergosterol biosynthesis 28 homolog ergosterol biosynthetic protein 28 homolog|probable ergosterol biosynthetic protein 28

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ERG28, check out the ERG28 Infographic

ERG28 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ERG28: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9UKR5

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ERG28 (C14orf1) (NM_007176) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ERG28 (C14orf1) (NM_007176) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ERG28 (C14orf1) (NM_007176) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9UKR5
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.