EIF5A (NM_001970) Human Recombinant Protein

EIF5A protein,

Product Info Summary

SKU: PROTP63241
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

EIF5A (NM_001970) Human Recombinant Protein

View all EIF5A recombinant proteins

SKU/Catalog Number

PROTP63241

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human eukaryotic translation initiation factor 5A (EIF5A), transcript variant B

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

EIF5A (NM_001970) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP63241)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

16.7 kDa

Amino Acid Sequence

MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK

Validation Images & Assay Conditions

Gene/Protein Information For EIF5A (Source: Uniprot.org, NCBI)

Gene Name

EIF5A

Full Name

Eukaryotic translation initiation factor 5A-1

Weight

16.7 kDa

Superfamily

eIF-5A family

Alternative Names

eIF4D; eIF-4D; eIF5A; EIF-5A; EIF5A1; eIF-5A1; eIF-5A-1; eIF5AI; Eukaryotic initiation factor 5A isoform 1; eukaryotic initiation factor 5A; eukaryotic translation initiation factor 5A; eukaryotic translation initiation factor 5A-1; MGC104255; MGC99547; Rev-binding Factor EIF5A EIF-5A1, eIF-4D, eIF5AI, EIF5A eukaryotic translation initiation factor 5A eukaryotic translation initiation factor 5A-1|eukaryotic initiation factor 5A|rev-binding factor

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on EIF5A, check out the EIF5A Infographic

EIF5A infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for EIF5A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP63241

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used EIF5A (NM_001970) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For EIF5A (NM_001970) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for EIF5A (NM_001970) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP63241
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.