EIF3F (NM_003754) Human Recombinant Protein

EIF3F protein,

Product Info Summary

SKU: PROTO00303
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

EIF3F (NM_003754) Human Recombinant Protein

View all EIF3F recombinant proteins

SKU/Catalog Number

PROTO00303

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human eukaryotic translation initiation factor 3, subunit F (EIF3F)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

EIF3F (NM_003754) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO00303)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

37.4 kDa

Amino Acid Sequence

MATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAAAPVPAAAPASSSDPAAAAAATAAPGQTPASAQAPAQTPAPALPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEKLVNL

Validation Images & Assay Conditions

Gene/Protein Information For EIF3F (Source: Uniprot.org, NCBI)

Gene Name

EIF3F

Full Name

Eukaryotic translation initiation factor 3 subunit F

Weight

37.4 kDa

Superfamily

eIF-3 subunit F family

Alternative Names

eIF3 p47; eIF-3-epsilon; eIF3-epsilon; eIF3f; eIF3-p47; EIF3S5eukaryotic translation initiation factor 3 subunit F; Eukaryotic translation initiation factor 3 subunit 5; eukaryotic translation initiation factor 3, subunit 5 (epsilon, 47kD); eukaryotic translation initiation factor 3, subunit 5 epsilon, 47kDa; eukaryotic translation initiation factor 3, subunit F EIF3F EIF3S5, MRT67, eIF3-p47 eukaryotic translation initiation factor 3 subunit F eukaryotic translation initiation factor 3 subunit F|deubiquitinating enzyme eIF3f|eIF-3-epsilon|eIF3-epsilon|eukaryotic translation initiation factor 3, subunit 5 (epsilon, 47kD)|eukaryotic translation initiation factor 3, subunit 5 epsilon, 47kDa

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on EIF3F, check out the EIF3F Infographic

EIF3F infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for EIF3F: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO00303

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used EIF3F (NM_003754) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For EIF3F (NM_003754) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for EIF3F (NM_003754) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO00303
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.