EIF1B (NM_005875) Human Recombinant Protein

EIF1B protein,

Product Info Summary

SKU: PROTO60739
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

EIF1B (NM_005875) Human Recombinant Protein

View all EIF1B recombinant proteins

SKU/Catalog Number

PROTO60739

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human eukaryotic translation initiation factor 1B (EIF1B)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

EIF1B (NM_005875) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO60739)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

12.6 kDa

Amino Acid Sequence

MSTIQNLQSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF

Validation Images & Assay Conditions

Gene/Protein Information For EIF1B (Source: Uniprot.org, NCBI)

Gene Name

EIF1B

Full Name

Eukaryotic translation initiation factor 1b

Weight

12.6 kDa

Superfamily

SUI1 family

Alternative Names

Eukaryotic translation initiation factor 1b EIF1B GC20 eukaryotic translation initiation factor 1B eukaryotic translation initiation factor 1b|protein translation factor SUI1 homolog GC20|translation factor sui1 homolog

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on EIF1B, check out the EIF1B Infographic

EIF1B infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for EIF1B: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO60739

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used EIF1B (NM_005875) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For EIF1B (NM_005875) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for EIF1B (NM_005875) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO60739
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.