EEF1B2 (NM_021121) Human Recombinant Protein

EEF1B2 protein,

Product Info Summary

SKU: PROTP24534
Size: 20 µg
Source: HEK293T

Product Name

EEF1B2 (NM_021121) Human Recombinant Protein

View all EEF1B2 recombinant proteins

SKU/Catalog Number

PROTP24534

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human eukaryotic translation elongation factor 1 beta 2 (EEF1B2), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

EEF1B2 (NM_021121) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP24534)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

24.6 kDa

Amino Acid Sequence

MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKI

Validation Images & Assay Conditions

Gene/Protein Information For EEF1B2 (Source: Uniprot.org, NCBI)

Gene Name

EEF1B2

Full Name

Elongation factor 1-beta

Weight

24.6 kDa

Superfamily

EF-1-beta/EF-1-delta family

Alternative Names

EEF1B; EEF1B1; EF1B; EF-1-beta; elongation factor 1-beta; eukaryotic translation elongation factor 1 beta 1; eukaryotic translation elongation factor 1 beta 2 EEF1B2 EEF1B, EEF1B1, EF1B eukaryotic translation elongation factor 1 beta 2 elongation factor 1-beta|EF-1-beta|eukaryotic translation elongation factor 1 beta 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on EEF1B2, check out the EEF1B2 Infographic

EEF1B2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for EEF1B2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP24534

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used EEF1B2 (NM_021121) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For EEF1B2 (NM_021121) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for EEF1B2 (NM_021121) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP24534
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.