EBAG9 (NM_004215) Human Recombinant Protein

EBAG9/RCAS1 protein,

Product Info Summary

SKU: PROTO00559
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

EBAG9 (NM_004215) Human Recombinant Protein

View all EBAG9/RCAS1 recombinant proteins

SKU/Catalog Number

PROTO00559

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human estrogen receptor binding site associated, antigen, 9 (EBAG9), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

EBAG9 (NM_004215) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO00559)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

24.2 kDa

Amino Acid Sequence

MAITQFRLFKFCTCLATVFSFLKRLICRSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGIPDGSTGFSSRLAATQDLPFIHQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGVKLS

Validation Images & Assay Conditions

Gene/Protein Information For EBAG9 (Source: Uniprot.org, NCBI)

Gene Name

EBAG9

Full Name

Receptor-binding cancer antigen expressed on SiSo cells

Weight

24.2 kDa

Alternative Names

Cancer-associated surface antigen RCAS1; EB9cancer associated surface antigen; estrogen receptor binding site associated, antigen, 9; Estrogen receptor-binding fragment-associated gene 9 protein; RCAS1PDAF; receptor-binding cancer antigen expressed on SiSo cells EBAG9 EB9, PDAF estrogen receptor binding site associated 9 receptor-binding cancer expressed on SiSo cells|cancer-associated surface RCAS1|estrogen receptor-binding fragment-associated gene 9 protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on EBAG9, check out the EBAG9 Infographic

EBAG9 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for EBAG9: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO00559

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used EBAG9 (NM_004215) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For EBAG9 (NM_004215) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for EBAG9 (NM_004215) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO00559
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product