EAF2 (NM_018456) Human Recombinant Protein

EAF2 protein,

Recombinant protein of human ELL associated factor 2 (EAF2)

Product Info Summary

SKU: PROTQ96CJ1
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

EAF2 (NM_018456) Human Recombinant Protein

View all EAF2 recombinant proteins

SKU/Catalog Number

PROTQ96CJ1

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ELL associated factor 2 (EAF2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

EAF2 (NM_018456) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96CJ1)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

28.6 kDa

Amino Acid Sequence

MNSAAGFSHLDRRERVLKLGESFEKQPRCAFHTVRYDFKPASIDTSSEGYLEVGEGEQVTITLPNIEGSTPPVTVFKGSKKPYLKECILIINHDTGECRLEKLSSNITVKKTRVEGSSKIQYRKEQQQQQMWNSARTPNLVKHSPSEDKMSPASPIDDIERELKAEASLMDQMSSCDSSSDSKSSSSSSSEDSSSDSEDEDCKSSTSDTGNCVSGHPTMTQYRIPDIDASHNRFRDNSGLLMNTLRNDLQLSESGSDSDD

Validation Images & Assay Conditions

Gene/Protein Information For EAF2 (Source: Uniprot.org, NCBI)

Gene Name

EAF2

Full Name

ELL-associated factor 2

Weight

28.6 kDa

Superfamily

EAF family

Alternative Names

BM040; ELL associated factor 2; testosterone regulated apoptosis inducer and tumor suppressor; Testosterone-regulated apoptosis inducer and tumor suppressor protein; TRAITSELL-associated factor 2; U19 EAF2 BM040, TRAITS, U19 ELL associated factor 2 ELL-associated factor 2|testosterone-regulated apoptosis inducer and tumor suppressor protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on EAF2, check out the EAF2 Infographic

EAF2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for EAF2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96CJ1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used EAF2 (NM_018456) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For EAF2 (NM_018456) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for EAF2 (NM_018456) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96CJ1
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.