DUSP13 (NM_016364) Human Recombinant Protein

Dusp13 protein,

Product Info Summary

SKU: PROTQ9UII6
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

DUSP13 (NM_016364) Human Recombinant Protein

View all Dusp13 recombinant proteins

SKU/Catalog Number

PROTQ9UII6

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human dual specificity phosphatase 13 (DUSP13), transcript variant 6

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

DUSP13 (NM_016364) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9UII6)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

22 kDa

Amino Acid Sequence

MDSLQKQDLRRPKIHGAVQASPYQPPTLASLQRLLWVRQAATLNHIDEVWPSLFLGDAYAARDKSKLIQLGITHVVNAAAGKFQVDTGAKFYRGMSLEYYGIEADDNPFFDLSVYFLPVARYIRAALSVPQGRVLVHCAMGVSRSATLVLAFLMIYENMTLVEAIQTVQAHRNICPNSGFLRQLQVLDNRLGRETGRF

Validation Images & Assay Conditions

Gene/Protein Information For DUSP13 (Source: Uniprot.org, NCBI)

Gene Name

DUSP13

Full Name

Dual specificity protein phosphatase 13 isoform A

Weight

22 kDa

Superfamily

protein-tyrosine phosphatase family

Alternative Names

Branching-enzyme interacting DSP; dual specificity phosphatase 13; Dual specificity phosphatase SKRP4; dual specificity protein phosphatase 13 isoform MDSP; dual specificity protein phosphatase 13; dual-specificity phosphatase SKRP4; DUSP13A; DUSP13B; EC 3.1.3.16; EC 3.1.3.48; FLJ32450; MDSPbranching-enzyme interacting dual-specificity protein phosphatase; Muscle-restricted DSP; Testis- and skeletal-muscle-specific DSP; TMDPBEDPSKRP4

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on DUSP13, check out the DUSP13 Infographic

DUSP13 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for DUSP13: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9UII6

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used DUSP13 (NM_016364) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For DUSP13 (NM_016364) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for DUSP13 (NM_016364) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9UII6
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product