DSCR4 (NM_005867) Human Recombinant Protein

DSCR4 protein,

Recombinant protein of human Down syndrome critical region gene 4 (DSCR4)

Product Info Summary

SKU: PROTP56555
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

DSCR4 (NM_005867) Human Recombinant Protein

View all DSCR4 recombinant proteins

SKU/Catalog Number

PROTP56555

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human Down syndrome critical region gene 4 (DSCR4)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

DSCR4 (NM_005867) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP56555)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

12.8 kDa

Amino Acid Sequence

MSLIILTRDDEPRIFTPDSDAASPALHSTSPLPDPASASPLHREEKILPKVCNIVSCLSFSLPASPTDSGLASPTIITREGQQFWAKCLIWKYQLYLHGLHKKSDGRRDKQISASPST

Validation Images & Assay Conditions

Gene/Protein Information For DSCR4 (Source: Uniprot.org, NCBI)

Gene Name

DSCR4

Full Name

Down syndrome critical region protein 4

Weight

12.8 kDa

Alternative Names

DCRBDown syndrome critical region protein B, 10DSCRBDown syndrome critical region protein 4; Down syndrome critical region gene 4 DSCR4 DCRB, DSCRB Down syndrome critical region 4 Down syndrome critical region gene 4|Down syndrome critical region protein 4|Down syndrome critical region protein B

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on DSCR4, check out the DSCR4 Infographic

DSCR4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for DSCR4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP56555

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used DSCR4 (NM_005867) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For DSCR4 (NM_005867) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for DSCR4 (NM_005867) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP56555
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.