DNAJC9 (NM_015190) Human Recombinant Protein

DjC9 protein,

Recombinant protein of human DnaJ (Hsp40) homolog, subfamily C, member 9 (DNAJC9)

Product Info Summary

SKU: PROTQ8WXX5
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

DNAJC9 (NM_015190) Human Recombinant Protein

View all DjC9 recombinant proteins

SKU/Catalog Number

PROTQ8WXX5

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human DnaJ (Hsp40) homolog, subfamily C, member 9 (DNAJC9)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

DNAJC9 (NM_015190) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8WXX5)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

29.7 kDa

Amino Acid Sequence

MGLLDLCEEVFGTADLYRVLGVRREASDGEVRRGYHKVSLQVHPDRVGEGDKEDATRRFQILGKVYSVLSDREQRAVYDEQGTVDEDSPVLTQDRDWEAYWRLLFKKISLEDIQAFEKTYKGSEEELADIKQAYLDFKGDMDQIMESVLCVQYTEEPRIRNIIQQAIDAGEVPSYNAFVKESKQKMNARKRRAQEEAKEAEMSRKELGLDEGVDSLKAAIQSRQKDRQKEMDNFLAQMEAKYCKSSKGGGKKSALKKEKK

Validation Images & Assay Conditions

Gene/Protein Information For DNAJC9 (Source: Uniprot.org, NCBI)

Gene Name

DNAJC9

Full Name

DnaJ homolog subfamily C member 9

Weight

29.7 kDa

Alternative Names

DnaJ (Hsp40) homolog, subfamily C, member 9; dnaJ homolog subfamily C member 9 DNAJC9 HDJC9, JDD1, SB73 DnaJ heat shock protein family (Hsp40) member C9 dnaJ homolog subfamily C member 9|DnaJ (Hsp40) homolog, subfamily C, member 9|DnaJ protein SB73

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on DNAJC9, check out the DNAJC9 Infographic

DNAJC9 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for DNAJC9: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8WXX5

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used DNAJC9 (NM_015190) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For DNAJC9 (NM_015190) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for DNAJC9 (NM_015190) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8WXX5
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.