DIRAS1 (NM_145173) Human Recombinant Protein

DIRAS1 protein,

Product Info Summary

SKU: PROTO95057
Size: 20 µg
Source: HEK293T

Product Name

DIRAS1 (NM_145173) Human Recombinant Protein

View all DIRAS1 recombinant proteins

SKU/Catalog Number

PROTO95057

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human DIRAS family, GTP-binding RAS-like 1 (DIRAS1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

DIRAS1 (NM_145173) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO95057)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

22.1 kDa

Amino Acid Sequence

MPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGSVEDIPVMLVGNKCDETQREVDTREAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVKGKCTLM

Validation Images & Assay Conditions

Gene/Protein Information For DIRAS1 (Source: Uniprot.org, NCBI)

Gene Name

DIRAS1

Full Name

GTP-binding protein Di-Ras1

Weight

22.1 kDa

Superfamily

small GTPase superfamily

Alternative Names

DIRAS family, GTP-binding RAS-like 1; Di-Ras1; Distinct subgroup of the Ras family member 1; GBTS1Small GTP-binding tumor suppressor 1; GTP-binding protein Di-Ras1; Ras-related inhibitor of cell growth; Rig; RIGFLJ42681 DIRAS1 Di-Ras1, GBTS1, RIG DIRAS family GTPase 1 GTP-binding protein Di-Ras1|DIRAS family, GTP-binding RAS-like 1|distinct subgroup of the Ras family member 1|ras-related inhibitor of cell growth|small GTP-binding tumor suppressor 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on DIRAS1, check out the DIRAS1 Infographic

DIRAS1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for DIRAS1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO95057

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used DIRAS1 (NM_145173) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For DIRAS1 (NM_145173) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for DIRAS1 (NM_145173) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO95057
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.