Diazepam Binding Inhibitor (DBI) (NM_020548) Human Recombinant Protein

ACBP protein,

Product Info Summary

SKU: PROTP07108
Size: 20 µg
Source: HEK293T

Product Name

Diazepam Binding Inhibitor (DBI) (NM_020548) Human Recombinant Protein

View all ACBP recombinant proteins

SKU/Catalog Number

PROTP07108

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein) (DBI), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Diazepam Binding Inhibitor (DBI) (NM_020548) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP07108)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

11.6 kDa

Amino Acid Sequence

MWGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI

Validation Images & Assay Conditions

Gene/Protein Information For DBI (Source: Uniprot.org, NCBI)

Gene Name

DBI

Full Name

Acyl-CoA-binding protein

Weight

11.6 kDa

Superfamily

ACBP family

Alternative Names

acyl-Coenzyme A binding domain containing 1; acyl-Coenzyme A bindingprotein); CCK-RP; cholecystokinin-releasing peptide, trypsin-sensitive; diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein); Diazepam-binding inhibitor; endozepine; EP; GABA receptor modulator; MGC70414 DBI ACBD1, ACBP, CCK-RP, EP diazepam binding inhibitor, acyl-CoA binding protein acyl-CoA-binding protein|GABA receptor modulator|acyl coenzyme A binding protein|acyl-Coenzyme A binding domain containing 1|cholecystokinin-releasing peptide, trypsin-sensitive|diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein)|diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein)|diazepam-binding inhibitor|endozepine|epididymis secretory sperm binding protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on DBI, check out the DBI Infographic

DBI infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for DBI: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP07108

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Diazepam Binding Inhibitor (DBI) (NM_020548) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Diazepam Binding Inhibitor (DBI) (NM_020548) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Diazepam Binding Inhibitor (DBI) (NM_020548) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP07108
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.