DHRS9 (NM_199204) Human Recombinant Protein

DHRS9 protein,

Product Info Summary

SKU: PROTQ9BPW9
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

DHRS9 (NM_199204) Human Recombinant Protein

View all DHRS9 recombinant proteins

SKU/Catalog Number

PROTQ9BPW9

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

DHRS9 (NM_199204) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9BPW9)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

35 kDa

Amino Acid Sequence

MLFWVLGLLILCGFLWTRKGKLKIEDITDKYIFITGCDSGFGNLAARTFDKKGFHVIAACLTESGSTALKAETSERLRTVLLDVTDPENVKRTAQWVKNQVGEKGLWGLINNAGVPGVLAPTDWLTLEDYREPIEVNLFGLISVTLNMLPLVKKAQGRVINVSSVGGRLAIVGGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFKTNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPVVECMDHALTSLFPKTHYAAGKDAKIFWIPLSHMPAALQDFLLLKQKAELANPKAV

Validation Images & Assay Conditions

Gene/Protein Information For DHRS9 (Source: Uniprot.org, NCBI)

Gene Name

DHRS9

Full Name

Dehydrogenase/reductase SDR family member 9

Weight

35 kDa

Superfamily

short-chain dehydrogenases/reductases (SDR) family

Alternative Names

dehydrogenase/reductase (SDR family) member 9,3alpha-HSD; EC 1.1; EC 1.1.1; EC 1.1.1.105; member 4,3-alpha-HSD; NADP-dependent retinol dehydrogenase/reductase; RDH15; RDH-E2; RDHL3ALPHA-HSD; RDHTBE DHRS9 3-alpha-HSD, 3ALPHA-HSD, RDH-E2, RDH-TBE, RDH15, RDHL, RDHTBE, RETSDR8, SDR9C4 dehydrogenase/reductase 9 dehydrogenase/reductase SDR family member 9|3-alpha hydroxysteroid dehydrogenase|NADP-dependent retinol dehydrogenase/reductase|dehydrogenase/reductase (SDR family) member 9|retinol dehydrogenase 15|retinol dehydrogenase homolog|short chain dehydrogenase/reductase family 9C member 4|short-chain dehydrogenase/reductase retSDR8|tracheobronchial epithelial cell-specific retinol dehydrogenase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on DHRS9, check out the DHRS9 Infographic

DHRS9 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for DHRS9: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9BPW9

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used DHRS9 (NM_199204) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For DHRS9 (NM_199204) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for DHRS9 (NM_199204) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9BPW9
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product