DHDH (NM_014475) Human Recombinant Protein

DHDH protein,

Recombinant protein of human dihydrodiol dehydrogenase (dimeric) (DHDH)

Product Info Summary

SKU: PROTQ9UQ10
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

DHDH (NM_014475) Human Recombinant Protein

View all DHDH recombinant proteins

SKU/Catalog Number

PROTQ9UQ10

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human dihydrodiol dehydrogenase (dimeric) (DHDH)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

DHDH (NM_014475) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9UQ10)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

36.2 kDa

Amino Acid Sequence

MALRWGIVSVGLISSDFTAVLQTLPRSEHQVVAVAARDLSRAKEFAQKHDIPKAYGSYEELAKDPSVEVAYIGTQHPQHKAAVMLCLAAGKAVLCEKPTGVNAAEVREMVAEARSRALFLMEAIWTRFFPASEALRSVLAQGTLGDLRVARAEFGKNLIHVPRAVDRAQAGGALLDIGIYCVQFTSMVFGGQKPEKISVVGRRHETGVDDTVTVLLQYPGEVHGSFTCSITVQLSNTASVSGTKGMVQLLNPCWCPTELVVKGEHKEFPLPPVPKDCNFDNGAGMSYEAKHVWECLRKGMKESPVIPLSESELLADILEEVRKAIGVTFPQDKR

Validation Images & Assay Conditions

Gene/Protein Information For DHDH (Source: Uniprot.org, NCBI)

Gene Name

DHDH

Full Name

Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase

Weight

36.2 kDa

Superfamily

Gfo/Idh/MocA family

Alternative Names

3-deoxyglucosone reductase; dihydrodiol dehydrogenase (dimeric); Dimeric dihydrodiol dehydrogenase; D-xylose 1-dehydrogenase; D-xylose-NADP dehydrogenase; EC 1.1.1.179,2DD; EC 1.3.1.20; HUM2DD; trans-1,2-dihydrobenzene-1,2-diol dehydrogenase DHDH 2DD, HUM2DD dihydrodiol dehydrogenase trans-1,2-dihydrobenzene-1,2-diol dehydrogenase|3-deoxyglucosone reductase|D-xylose 1-dehydrogenase|D-xylose-NADP dehydrogenase|dihydrodiol dehydrogenase (dimeric)

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on DHDH, check out the DHDH Infographic

DHDH infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for DHDH: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9UQ10

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used DHDH (NM_014475) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For DHDH (NM_014475) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for DHDH (NM_014475) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9UQ10
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.