DGKA (NM_201445) Human Recombinant Protein

DGK-alpha protein,

Recombinant protein of human diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 2

Product Info Summary

SKU: PROTP23743
Size: 20 µg
Source: HEK293T

Product Name

DGKA (NM_201445) Human Recombinant Protein

View all DGK-alpha recombinant proteins

SKU/Catalog Number

PROTP23743

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

DGKA (NM_201445) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP23743)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

82.5 kDa

Amino Acid Sequence

MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHLSLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPLLVLLGLEMTLKDDGQHMWRPKRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESGRCDRCQKKIRIYHSLTGLHCVWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKTSQKTMDDLNLSTSEALRIDPVPNTHPLLVFVNPKSGGKQGQRVLWKFQYILNPRQVFNLLKDGPEIGLRLFKDVPDSRILVCGGDGTVGWILETIDKANLPVLPPVAVLPLGTGNDLARCLRWGGGYEGQNLAKILKDLEMSKVVHMDRWSVEVIPQQTEEKSDPVPFQIINNYFSIGVDASIAHRFHIMREKYPEKFNSRMKNKLWYFEFATSESIFSTCKKLEESLTVEICGKPLDLSNLSLEGIAVLNIPSMHGGSNLWGDTRRPHGDIYGINQALGATAKVITDPDILKTCVPDLSDKRLEVVGLEGAIEMGQIYTKLKNAGRRLAKCSEITFHTTKTLPMQIDGEPWMQTPCTIKITHKNQMPMLMGPPPRSTNFFGFLS

Validation Images & Assay Conditions

Gene/Protein Information For DGKA (Source: Uniprot.org, NCBI)

Gene Name

DGKA

Full Name

Diacylglycerol kinase alpha

Weight

82.5 kDa

Superfamily

eukaryotic diacylglycerol kinase family

Alternative Names

DAG kinase alpha; DAGK; DAGK1; DAGK1diacylglycerol kinase, alpha (80kD); DGKA; DGKalpha; DGK-alpha; DGK-alphaEC 2.7.1.107; diacylglycerol kinase alpha; diacylglycerol kinase, alpha 80kDa; Diglyceride kinase alpha; MGC12821,80 kDa diacylglycerol kinase; MGC42356 DGKA DAGK, DAGK1, DGK-alpha diacylglycerol kinase alpha diacylglycerol kinase alpha|80 kDa diacylglycerol kinase|DAG kinase alpha|diacylglycerol kinase, alpha 80kDa|diglyceride kinase alpha

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on DGKA, check out the DGKA Infographic

DGKA infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for DGKA: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP23743

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used DGKA (NM_201445) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For DGKA (NM_201445) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for DGKA (NM_201445) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP23743
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product