DGCR6 (NM_005675) Human Recombinant Protein

DGCR6 protein,

Product Info Summary

SKU: PROTQ14129
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

DGCR6 (NM_005675) Human Recombinant Protein

View all DGCR6 recombinant proteins

SKU/Catalog Number

PROTQ14129

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens DiGeorge syndrome critical region gene 6 (DGCR6)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

DGCR6 (NM_005675) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ14129)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

24.8 kDa

Amino Acid Sequence

MERYAGALEEVADGARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEIQHLTEKSLYNQRLRLQNEHRVLRQALRQKHQEAQQACRPHNLPVLQAAQQRELEAVEHRIREEQRAMDQKIVLELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLLELIRKLQQRGCWAGKAALGLGGPWQLPAAQCDQKGSPVPP

Validation Images & Assay Conditions

Gene/Protein Information For DGCR6 (Source: Uniprot.org, NCBI)

Gene Name

DGCR6

Full Name

Protein DGCR6

Weight

24.8 kDa

Superfamily

gonadal family

Alternative Names

DiGeorge syndrome critical region 6; DiGeorge syndrome critical region gene 6; DiGeorge syndrome critical region protein 6; protein DGCR6 DGCR6 DiGeorge syndrome critical region gene 6 protein DGCR6|DiGeorge syndrome critical region protein 6

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on DGCR6, check out the DGCR6 Infographic

DGCR6 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for DGCR6: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ14129

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used DGCR6 (NM_005675) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For DGCR6 (NM_005675) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for DGCR6 (NM_005675) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ14129
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product