Product Info Summary
SKU: | PROTP08176 |
---|---|
Size: | 100ug, 500ug, 1mg |
Source: | Escherichia coli |
Product info
Product Name
Der-P1 Der P1 Protein Recombinant Protein
SKU/Catalog Number
PROTP08176
Size
100ug, 500ug, 1mg
Description
The E. coli derived recombinant protein contains the Dermatophagoides pteronyssinus Dust Mite Der P1 protein (a.a. 20-320) and fused to a 6 His Tag at C-terminus, having a total Mw of 34.5kDa, pI 5.6.
Storage & Handling
Der-P1 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
Cite This Product
Der-P1 Der P1 Protein Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP08176)
Formulation
60mM NaCl and 50mM Tris-HCl pH 8.0.
Purity
Protein is greater than 95% pure as determined by 10% SDS-PAGE (coomassie staining).
Amino Acid Sequence
MSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLSDLSLDEFK NRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSAWAFS GVAATESAYLAYRNQSLDLAEQELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVA REQSCRRPNAQRFGISNYCQIYPPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTI IQRDNGYQPNYHAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPY VVILHHHHHH
Assay dilution & Images
Validation Images & Assay Conditions
![recombinant protein thumbnail_1 recombinant protein thumbnail_1](https://www.bosterbio.com/media/catalog/product/r/e/recombinant-protein-thumbnail_1.png)
Click image to see more details
Recombinant protein fun image
Specific Publications For Der-P1 Der P1 Protein Recombinant Protein (PROTP08176)
Hello CJ!
No publications found for PROTP08176
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Der-P1 Der P1 Protein Recombinant Protein?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Der-P1 Der P1 Protein Recombinant Protein
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question