CTNS (NM_004937) Human Recombinant Protein

CTNS protein,

Purified recombinant protein of Homo sapiens cystinosis, nephropathic (CTNS), transcript variant 2

Product Info Summary

SKU: PROTO60931
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

CTNS (NM_004937) Human Recombinant Protein

View all CTNS recombinant proteins

SKU/Catalog Number

PROTO60931

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens cystinosis, nephropathic (CTNS), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CTNS (NM_004937) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO60931)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

41.6 kDa

Amino Acid Sequence

MIRNWLTIFILFPLKLVEKCESSVSLTVPPVVKLENGSSTNVSLTLRPPLNATLVITFEITFRSKNITILELPDEVVVPPGVTNSSFQVTSQNVGQLTVYLHGNHSNQTGPRIRFLVIRSSAISIINQVIGWIYFVAWSISFYPQVIMNWRRKSVIGLSFDFVALNLTGFVAYSVFNIGLLWVPYIKEQFLLKYPNGVNPVNSNDVFFSLHAVVLTLIIIVQCCLYERGGQRVSWPAIGFLVLAWLFAFVTMIVAAVGVITWLQFLFCFSYIKLAVTLVKYFPQAYMNFYYKSTEGWSIGNVLLDFTGGSFSLLQMFLQSYNNDQWTLIFGDPTKFGLGVFSIVFDVVFFIQHFCLYRKRPGYDQLN

Validation Images & Assay Conditions

Gene/Protein Information For CTNS (Source: Uniprot.org, NCBI)

Gene Name

CTNS

Full Name

Cystinosin

Weight

41.6 kDa

Superfamily

cystinosin family

Alternative Names

CTNS-LSB; cystinosin; cystinosis, nephropathic; PQLC4 CTNS CTNS-LSB, PQLC4, SLC66A4 cystinosin, lysosomal cystine transporter cystinosin|cystinosis nephropathic

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CTNS, check out the CTNS Infographic

CTNS infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CTNS: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO60931

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CTNS (NM_004937) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CTNS (NM_004937) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CTNS (NM_004937) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO60931
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.