CRTAP (NM_006371) Human Recombinant Protein

CRTAP protein,

Product Info Summary

SKU: PROTO75718
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

CRTAP (NM_006371) Human Recombinant Protein

View all CRTAP recombinant proteins

SKU/Catalog Number

PROTO75718

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human cartilage associated protein (CRTAP)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CRTAP (NM_006371) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO75718)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

43.9 kDa

Amino Acid Sequence

MEPGRRGAAALLALLCVACALRAGRAQYERYSFRSFPRDELMPLESAYRHALDKYSGEHWAESVGYLEISLRLHRLLRDSEAFCHRNCSAAPQPEPAAGLASYPELRLFGGLLRRAHCLKRCKQGLPAFRQSQPSRDVLADFQRREPYKFLQFAYFKANNLPKAIAAAHTFLLKHPDDEMMKRNMAYYKSLPGAEDYIKDLETKSYESLFIRAVRAYNGENWRTSITDMELALPDFFKAFYECLAACEGSREIKDFKDFYLSIADHYVEVLECKIQCEENLTPVIGGYPVEKFVATMYHYLQFAYYKLNDLKNAAPCAVSYLLFDQNDKVMQQNLVYYQYHRDTWGLSDEHFQPRPEAVQFFNVTTLQKELYDFAKENIMDDDEGEVVEYVDDLLELEETS

Validation Images & Assay Conditions

Gene/Protein Information For CRTAP (Source: Uniprot.org, NCBI)

Gene Name

CRTAP

Full Name

Cartilage-associated protein

Weight

43.9 kDa

Superfamily

leprecan family

Alternative Names

cartilage associated protein; cartilage-associated protein; CASPLEPREL3; leprecan-like 3 CRTAP CASP, LEPREL3, OI7, P3H5 cartilage associated protein cartilage-associated protein|leprecan-like 3|prolyl 3-hydroxylase family member 5 (non-enzymatic)

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CRTAP, check out the CRTAP Infographic

CRTAP infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CRTAP: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO75718

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CRTAP (NM_006371) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CRTAP (NM_006371) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CRTAP (NM_006371) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO75718
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.