CRCP (NM_001040647) Human Recombinant Protein

Crcp protein,

Product Info Summary

SKU: PROTO75575
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

CRCP (NM_001040647) Human Recombinant Protein

View all Crcp recombinant proteins

SKU/Catalog Number

PROTO75575

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human CGRP receptor component (CRCP), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CRCP (NM_001040647) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO75575)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

12.9 kDa

Amino Acid Sequence

MEVKDANSALLSNYETLKYISKTPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNVAMDEEDPA

Validation Images & Assay Conditions

Gene/Protein Information For Crcp (Source: Uniprot.org, NCBI)

Gene Name

Crcp

Full Name

DNA-directed RNA polymerase III subunit RPC9

Weight

12.9 kDa

Superfamily

eukaryotic RPC9 RNA polymerase subunit family

Alternative Names

Calcitonin gene-related peptide-receptor component protein; CGRP receptor component; CGRPRCP; CGRP-RCPRNA polymerase III subunit C9; CGRP-receptor component protein; DNA-directed RNA polymerase III subunit RPC9; hsC17; RCP9; RCPMGC111194 Crcp|AL022669|calcitonin gene-related peptide-receptor component protein|DNA-directed RNA polymerase III subunit RPC9|CGRP-RCP|CGRP-receptor component protein|CGRPRCP|RNA polymerase III subunit C9

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on Crcp, check out the Crcp Infographic

Crcp infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Crcp: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO75575

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CRCP (NM_001040647) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CRCP (NM_001040647) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CRCP (NM_001040647) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO75575
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.