COX7C (NM_001867) Human Recombinant Protein

COX7C protein,

Recombinant protein of human cytochrome c oxidase subunit VIIc (COX7C), nuclear gene encoding mitochondrial protein

Product Info Summary

SKU: PROTP15954
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

COX7C (NM_001867) Human Recombinant Protein

View all COX7C recombinant proteins

SKU/Catalog Number

PROTP15954

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human cytochrome c oxidase subunit VIIc (COX7C), nuclear gene encoding mitochondrial protein

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

COX7C (NM_001867) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP15954)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

5.3 kDa

Amino Acid Sequence

MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQLLKT

Validation Images & Assay Conditions

Gene/Protein Information For COX7C (Source: Uniprot.org, NCBI)

Gene Name

COX7C

Full Name

Cytochrome c oxidase subunit 7C, mitochondrial

Weight

5.3 kDa

Superfamily

cytochrome c oxidase VIIc family

Alternative Names

Cytochrome c oxidase polypeptide VIIc; cytochrome c oxidase subunit VIIc; cytochrome-c oxidase chain VIIc; mitochondrial COX7C cytochrome c oxidase subunit 7C cytochrome c oxidase subunit 7C, mitochondrial|cytochrome c oxidase polypeptide VIIc|cytochrome c oxidase subunit VIIc|cytochrome-c oxidase chain VIIc

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on COX7C, check out the COX7C Infographic

COX7C infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for COX7C: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP15954

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used COX7C (NM_001867) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For COX7C (NM_001867) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for COX7C (NM_001867) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP15954
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.