COQ9 (NM_020312) Human Recombinant Protein

COQ9 protein,

Product Info Summary

SKU: PROTO75208
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

COQ9 (NM_020312) Human Recombinant Protein

View all COQ9 recombinant proteins

SKU/Catalog Number

PROTO75208

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human coenzyme Q9 homolog (S. cerevisiae) (COQ9)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

COQ9 (NM_020312) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO75208)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

35.3 kDa

Amino Acid Sequence

MAAAAVSGALGRAGWRLLQLRCLPVARCRQALVPRAFHASAVGLRSSDEQKQQPPNSFSQQHSETQGAEKPDPESSHSPPRYTDQGGEEEEDYESEEQLQHRILTAALEFVPAHGWTAEAIAEGAQSLGLSSAAASMFGKDGSELILHFVTQCNTRLTRVLEEEQKLVQLGQAEKRKTDQFLRDAVETRLRMLIPYIEHWPRALSILMLPHNIPSSLSLLTSMVDDMWHYAGDQSTDFNWYTRRAMLAAIYNTTELVMMQDSSPDFEDTWRFLENRVNDAMNMGHTAKQVKSTGEALVQGLMGAAVTLKNLTGLNQRR

Validation Images & Assay Conditions

Gene/Protein Information For COQ9 (Source: Uniprot.org, NCBI)

Gene Name

COQ9

Full Name

Ubiquinone biosynthesis protein COQ9, mitochondrial

Weight

35.3 kDa

Superfamily

COQ9 family

Alternative Names

C16orf49DKFZp434K046; chromosome 16 open reading frame 49; coenzyme Q9 homolog (S. cerevisiae); coenzyme Q9 homolog (yeast); DKFZP434K046; ubiquinone biosynthesis protein COQ9, mitochondrial COQ9 C16orf49, COQ10D5 coenzyme Q9 ubiquinone biosynthesis protein COQ9, mitochondrial|coenzyme Q9 homolog

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on COQ9, check out the COQ9 Infographic

COQ9 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for COQ9: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO75208

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used COQ9 (NM_020312) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For COQ9 (NM_020312) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for COQ9 (NM_020312) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO75208
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product