COQ7 (NM_016138) Human Recombinant Protein

COQ7 protein,

Recombinant protein of human coenzyme Q7 homolog, ubiquinone (yeast) (COQ7)

Product Info Summary

SKU: PROTQ99807
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

COQ7 (NM_016138) Human Recombinant Protein

View all COQ7 recombinant proteins

SKU/Catalog Number

PROTQ99807

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human coenzyme Q7 homolog, ubiquinone (yeast) (COQ7)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

COQ7 (NM_016138) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ99807)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

24.1 kDa

Amino Acid Sequence

MSCAGAAAAPRLWRLRPGARRSLSAYGRRTSVRFRSSGMTLDNISRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVMFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDIGLDHDAELAPAYAVLKSIIQAGCRVAIYLSERL

Validation Images & Assay Conditions

Gene/Protein Information For COQ7 (Source: Uniprot.org, NCBI)

Gene Name

COQ7

Full Name

5-demethoxyubiquinone hydroxylase, mitochondrial

Weight

24.1 kDa

Superfamily

COQ7 family

Alternative Names

CAT5; CLK1; CLK-1; Coenzyme Q biosynthesis protein 7 homolog; coenzyme Q, 7 (rat, yeast) homolog; coenzyme Q7 homolog, ubiquinone (yeast); COQ7 coenzyme Q, 7 homolog ubiquinone; placental protein KG-20; Timing protein clk-1 homolog; ubiquinone biosynthesis protein COQ7 homolog COQ7 CAT5, CLK-1, CLK1, COQ10D8 coenzyme Q7, hydroxylase 5-demethoxyubiquinone hydroxylase, mitochondrial|COQ7 coenzyme Q, 7 homolog ubiquinone|DMQ hydroxylase|coenzyme Q biosynthesis protein 7 homolog|coenzyme Q7 homolog, ubiquinone|placental protein KG-20|timing protein clk-1 homolog|ubiquinone biosynthesis monooxygenase COQ7|ubiquinone biosynthesis protein COQ7 homolog

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on COQ7, check out the COQ7 Infographic

COQ7 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for COQ7: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ99807

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used COQ7 (NM_016138) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For COQ7 (NM_016138) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for COQ7 (NM_016138) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ99807
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.