COPS7A (NM_016319) Human Recombinant Protein

Cops7a protein,

Product Info Summary

SKU: PROTQ9UBW8
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

COPS7A (NM_016319) Human Recombinant Protein

View all Cops7a recombinant proteins

SKU/Catalog Number

PROTQ9UBW8

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human COP9 constitutive photomorphogenic homolog subunit 7A (Arabidopsis) (COPS7A)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

COPS7A (NM_016319) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9UBW8)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

30.1 kDa

Amino Acid Sequence

MSAEVKVTGQNQEQFLLLAKSAKGAALATLIHQVLEAPGVYVFGELLDMPNVRELAESDFASTFRLLTVFAYGTYADYLAEARNLPPLTEAQKNKLRHLSVVTLAAKVKCIPYAVLLEALALRNVRQLEDLVIEAVYADVLRGSLDQRNQRLEVDYSIGRDIQRQDLSAIARTLQEWCVGCEVVLSGIEEQVSRANQHKEQQLGLKQQIESEVANLKKTIKVTTAAAAAATSQDPEQHLTELREPAPGTNQRQPSKKASKGKGLRGSAKIWSKSN

Validation Images & Assay Conditions

Gene/Protein Information For COPS7A (Source: Uniprot.org, NCBI)

Gene Name

COPS7A

Full Name

COP9 signalosome complex subunit 7a

Weight

30.1 kDa

Superfamily

CSN7/EIF3M family

Alternative Names

COP9 (constitutive photomorphogenic, Arabidopsis, homolog) subunit 7A; COP9 complex subunit 7a; COP9 constitutive photomorphogenic homolog subunit 7A (Arabidopsis); COP9 signalosome complex subunit 7a; CSN7AMGC110877; Dermal papilla-derived protein 10; DERP10; JAB1-containing signalosome subunit 7a; SGN7a; Signalosome subunit 7a Cops7a|D6Ertd35, D6Ertd35e, SGN7a|COP9 signalosome subunit 7A|COP9 signalosome complex subunit 7a|COP9 (constitutive photomorphogenic) homolog, subunit 7a|COP9 (constitutive photomorphogenic), subunit 7a|COP9 complex S7a|JAB1-containing signalosome subunit 7a|signalosome subunit 7a

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on COPS7A, check out the COPS7A Infographic

COPS7A infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for COPS7A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9UBW8

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used COPS7A (NM_016319) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For COPS7A (NM_016319) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for COPS7A (NM_016319) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9UBW8
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.