CNOT4 (NM_001008225) Human Recombinant Protein

CNOT4 protein,

Recombinant protein of human CCR4-NOT transcription complex, subunit 4 (CNOT4), transcript variant 2

Product Info Summary

SKU: PROTO95628
Size: 20 µg
Source: HEK293T

Product Name

CNOT4 (NM_001008225) Human Recombinant Protein

View all CNOT4 recombinant proteins

SKU/Catalog Number

PROTO95628

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human CCR4-NOT transcription complex, subunit 4 (CNOT4), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CNOT4 (NM_001008225) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO95628)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

62.9 kDa

Amino Acid Sequence

MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPEDPAVYKPLSQEELQRIKNEKKQKQNERKQKISENRKHLASVRVVQKNLVFVVGLSQRLADPEVLKRPEYFGKFGKIHKVVINNSTSYAGSQGPSASAYVTYIRSEDALRAIQCVNNVVVDGRTLKASLGTTKYCSYFLKNMQCPKPDCMYLHELGDEAASFTKEEMQAGKHQEYEQKLLQELYKLNPNFLQLSTGSVDKNKNKVTPLQSPIDKPSDSLSIGNGDNSQQISNSDTPSPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDIFRHPNPIPSGLPPFPSSPQTSSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIEKELSVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRFPQFQQHRAVYNSFSFPGQAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIPVAGEEEVKVSTMPLSTSSHSLQQGQQPTSLHTTVA

Validation Images & Assay Conditions

Gene/Protein Information For CNOT4 (Source: Uniprot.org, NCBI)

Gene Name

CNOT4

Full Name

CCR4-NOT transcription complex subunit 4

Weight

62.9 kDa

Alternative Names

CCR4-associated factor 4; CCR4-NOT transcription complex, subunit 4; E3 ubiquitin-protein ligase CNOT4; EC 6.3.2.-; NOT4yeast) homolog CNOT4 CLONE243, NOT4, NOT4H CCR4-NOT transcription complex subunit 4 CCR4-NOT transcription complex subunit 4|CCR4-associated factor 4|E3 ubiquitin-protein ligase CNOT4|NOT4 (negative regulator of transcription 4, yeast) homolog|RING-type E3 ubiquitin transferase CNOT4|potential transcriptional repressor NOT4Hp

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CNOT4, check out the CNOT4 Infographic

CNOT4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CNOT4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO95628

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CNOT4 (NM_001008225) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CNOT4 (NM_001008225) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CNOT4 (NM_001008225) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO95628
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.