CMTM7 (NM_181472) Human Recombinant Protein

Cmtm7 protein,

Recombinant protein of human CKLF-like MARVEL transmembrane domain containing 7 (CMTM7), transcript variant 2

Product Info Summary

SKU: PROTQ96FZ5
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

CMTM7 (NM_181472) Human Recombinant Protein

View all Cmtm7 recombinant proteins

SKU/Catalog Number

PROTQ96FZ5

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human CKLF-like MARVEL transmembrane domain containing 7 (CMTM7), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CMTM7 (NM_181472) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96FZ5)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

15.3 kDa

Amino Acid Sequence

MSHGAGLVRTTCSSGSALGPGAGAAQPSASPLEGLLDLSYPRTHAALLKVAQMVTLLIAFICVRSSLWTNYSAYSYFEVVTICDLIMILAFYLVHLFRFYRVLTCISWPLSIFGFMATFLCMASIWLSYKISCVTQSTDAAV

Validation Images & Assay Conditions

Gene/Protein Information For CMTM7 (Source: Uniprot.org, NCBI)

Gene Name

CMTM7

Full Name

CKLF-like MARVEL transmembrane domain-containing protein 7

Weight

15.3 kDa

Superfamily

chemokine-like factor family

Alternative Names

chemokine-like factor super family 7; chemokine-like factor super family member 7 variant 2; chemokine-like factor superfamily 7; Chemokine-like factor superfamily member 7; CKLF-like MARVEL transmembrane domain containing 7; CKLF-like MARVEL transmembrane domain-containing protein 7; CKLFSF7; FLJ30992 Cmtm7|AI481279, Cklfs, Cklfsf7, LNV|CKLF-like MARVEL transmembrane domain containing 7|CKLF-like MARVEL transmembrane domain-containing protein 7|chemokine-like factor super family 7|chemokine-like factor superfamily member 7

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CMTM7, check out the CMTM7 Infographic

CMTM7 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CMTM7: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used CMTM7 (NM_181472) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CMTM7 (NM_181472) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CMTM7 (NM_181472) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96FZ5
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.