CKS2 (NM_001827) Human Recombinant Protein

CKS2 protein,

Product Info Summary

SKU: PROTP33552
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

CKS2 (NM_001827) Human Recombinant Protein

View all CKS2 recombinant proteins

SKU/Catalog Number

PROTP33552

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human CDC28 protein kinase regulatory subunit 2 (CKS2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CKS2 (NM_001827) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP33552)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

9.7 kDa

Amino Acid Sequence

MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK

Validation Images & Assay Conditions

Gene/Protein Information For CKS2 (Source: Uniprot.org, NCBI)

Gene Name

CKS2

Full Name

Cyclin-dependent kinases regulatory subunit 2

Weight

9.7 kDa

Superfamily

CKS family

Alternative Names

CDC28 protein kinase 2; CDC28 protein kinase regulatory subunit 2; CKS1(S. cerevisiae Cdc28/Cdc2 kinase subunit) homolog-2; CKS-2; CKSHS2; cyclin-dependent kinases regulatory subunit 2 CKS2 CKSHS2 CDC28 protein kinase regulatory subunit 2 cyclin-dependent kinases regulatory subunit 2|CDC28 protein kinase 2|CKS-2|CKS1(S. cerevisiae Cdc28/Cdc2 kinase subunit) homolog-2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CKS2, check out the CKS2 Infographic

CKS2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CKS2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP33552

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CKS2 (NM_001827) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CKS2 (NM_001827) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CKS2 (NM_001827) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP33552
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.