CENPH (NM_022909) Human Recombinant Protein

Cenph protein,

Product Info Summary

SKU: PROTQ9H3R5
Size: 20 µg
Source: HEK293T

Product Name

CENPH (NM_022909) Human Recombinant Protein

View all Cenph recombinant proteins

SKU/Catalog Number

PROTQ9H3R5

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human centromere protein H (CENPH)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CENPH (NM_022909) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9H3R5)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

28.3 kDa

Amino Acid Sequence

MEEQPQMQDADEPADSGGEGRAGGPPQVAGAQAACSEDRMTLLLRLRAQTKQQLLEYKSMVDASEEKTPEQIMQEKQIEAKIEDLENEIEEVKVAFEIKKLALDRMRLSTALKKNLEKISRQSSVLMDNMKHLLELNKLIMKSQQESWDLEEKLLDIRKKRLQLKQASESKLLEIQTEKNKQKIDLDSMENSERIKIIRQNLQMEIKITTVIQHVFQNLILGSKVNWAEDPALKEIVLQLEKNVDMM

Validation Images & Assay Conditions

Gene/Protein Information For CENPH (Source: Uniprot.org, NCBI)

Gene Name

CENPH

Full Name

Centromere protein H

Weight

28.3 kDa

Superfamily

CENP-H/MCM16 family

Alternative Names

CENP-H; centromere protein H; ICEN35; Interphase centromere complex protein 35; kinetochore protein CENP-H; NNF1; PMF1 Cenph|1700021I11Rik, 2410018A12Rik, 2610042E16Rik, 2810046K12Rik, AU044255, CENP, CENP-H, E, ENP|centromere protein H|centromere protein H|centromere auto H

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CENPH, check out the CENPH Infographic

CENPH infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CENPH: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9H3R5

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CENPH (NM_022909) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CENPH (NM_022909) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CENPH (NM_022909) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9H3R5
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product