CDC42EP1 (NM_007061) Human Recombinant Protein

CDC42EP1 protein,

Recombinant protein of human CDC42 effector protein (Rho GTPase binding) 1 (CDC42EP1), transcript variant 2

Product Info Summary

SKU: PROTQ00587
Size: 20 µg
Source: HEK293T

Product Name

CDC42EP1 (NM_007061) Human Recombinant Protein

View all CDC42EP1 recombinant proteins

SKU/Catalog Number

PROTQ00587

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human CDC42 effector protein (Rho GTPase binding) 1 (CDC42EP1), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CDC42EP1 (NM_007061) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ00587)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

39.5 kDa

Amino Acid Sequence

MPGPQGGRGAATMSLGKLSPVGWVSSSQGKRRLTADMISHPLGDFRHTMHVGRGGDVFGDTSFLSNHGGSSGSTHRSPRSFLAKKLQLVRRVGAPPRRMASPPAPSPAPPAISPIIKNAISLPQLNQAAYDSLVVGKLSFDSSPTSSTDGHSSYGLDSGFCTISRLPRSEKPHDRDRDGSFPSEPGLRRSDSLLSFRLDLDLGPSLLSELLGVMSLPEAPAAETPAPAANPPAPTANPTGPAANPPATTANPPAPAATPTGPAANPPAPAASSTPHGHCPNGVTAGLGPVAEVKSSPVGGGPRGPAGPALGRHWGAGWDGGHHYPEMDARQERVEVLPQARASWESLDEEWRAPQAGSRTPVPSTVQANTFEFADAEEDDEVKV

Validation Images & Assay Conditions

Gene/Protein Information For CDC42EP1 (Source: Uniprot.org, NCBI)

Gene Name

CDC42EP1

Full Name

Cdc42 effector protein 1

Weight

39.5 kDa

Superfamily

BORG/CEP family

Alternative Names

Binder of Rho GTPases 5; Borg5; BORG5cdc42 effector protein 1; CDC42 effector protein (Rho GTPase binding) 1; CEP155 kDa bone marrow stromal/endothelial cell protein; MSE55MGC15316; serum constituent protein; Serum protein MSE55 CDC42EP1 BORG5, CEP1, MSE55 CDC42 effector protein 1 cdc42 effector protein 1|55 kDa bone marrow stromal/endothelial cell protein|CDC42 effector protein (Rho GTPase binding) 1|binder of Rho GTPases 5|serum constituent protein|serum protein MSE55

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CDC42EP1, check out the CDC42EP1 Infographic

CDC42EP1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CDC42EP1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ00587

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CDC42EP1 (NM_007061) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CDC42EP1 (NM_007061) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CDC42EP1 (NM_007061) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ00587
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.