CD94 (KLRD1) (NM_002262) Human Recombinant Protein

CD94 protein,

Product Info Summary

SKU: PROTQ13241
Size: 20 µg
Source: HEK293T

Product Name

CD94 (KLRD1) (NM_002262) Human Recombinant Protein

View all CD94 recombinant proteins

SKU/Catalog Number

PROTQ13241

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human killer cell lectin-like receptor subfamily D, member 1 (KLRD1), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CD94 (KLRD1) (NM_002262) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ13241)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

20.3 kDa

Amino Acid Sequence

MAVFKTTLWRLISGTLGIICLSLMATLGILLKNSFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGNALDESCEDKNRYICKQQLI

Validation Images & Assay Conditions

Gene/Protein Information For KLRD1 (Source: Uniprot.org, NCBI)

Gene Name

KLRD1

Full Name

Natural killer cells antigen CD94

Weight

20.3 kDa

Alternative Names

CD94 antigen; CD94; CD94natural killer cells antigen CD94; Killer cell lectin-like receptor subfamily D member 1; killer cell lectin-like receptor subfamily D, member 1; KLRD1; KP43; NK cell receptor KLRD1 CD94 killer cell lectin like receptor D1 natural killer cells CD94|CD94 |KP43|NK cell receptor|killer cell lectin-like receptor subfamily D, member 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on KLRD1, check out the KLRD1 Infographic

KLRD1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for KLRD1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used CD94 (KLRD1) (NM_002262) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CD94 (KLRD1) (NM_002262) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CD94 (KLRD1) (NM_002262) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ13241
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.