CCDC56 (COA3) (NM_001040431) Human Recombinant Protein

CCDC56 protein,

Recombinant protein of human coiled-coil domain containing 56 (CCDC56)

Product Info Summary

SKU: PROTQ9Y2R0
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

CCDC56 (COA3) (NM_001040431) Human Recombinant Protein

View all CCDC56 recombinant proteins

SKU/Catalog Number

PROTQ9Y2R0

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human coiled-coil domain containing 56 (CCDC56)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CCDC56 (COA3) (NM_001040431) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y2R0)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

11.6 kDa

Amino Acid Sequence

MASSGAGDPLDSKRGEAPFAQRIDPTREKLTPEQLHSMRQAELAQWQKVLPRRRTRNIVTGLGIGALVLAIYGYTFYSISQERFLDELEDEAKAARARALARASGS

Validation Images & Assay Conditions

Gene/Protein Information For COA3 (Source: Uniprot.org, NCBI)

Gene Name

COA3

Full Name

Cytochrome c oxidase assembly factor 3 homolog, mitochondrial

Weight

11.6 kDa

Superfamily

COA3 family

Alternative Names

coiled-coil domain containing 56; coiled-coil domain-containing protein 56; FLJ50764; HSPC009 COA3 CCDC56, COX25, HSPC009, MC4DN14, MITRAC12 cytochrome c oxidase assembly factor 3 cytochrome c oxidase assembly factor 3 homolog, mitochondrial|coiled-coil domain-containing protein 56|cytochrome C oxidase assembly factor 3 homolog, mitochondrial|cytochrome c oxidase assembly protein 3 homolog, mitochondrial|mitochondrial translation regulation assembly intermediate of cytochrome c oxidase protein of 12 kDa

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on COA3, check out the COA3 Infographic

COA3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for COA3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9Y2R0

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CCDC56 (COA3) (NM_001040431) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CCDC56 (COA3) (NM_001040431) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CCDC56 (COA3) (NM_001040431) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y2R0
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product