CCBL1 (KYAT1) (NM_001122671) Human Recombinant Protein

KYAT1 protein,

Product Info Summary

SKU: PROTQ16773
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

CCBL1 (KYAT1) (NM_001122671) Human Recombinant Protein

View all KYAT1 recombinant proteins

SKU/Catalog Number

PROTQ16773

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human cysteine conjugate-beta lyase, cytoplasmic (CCBL1), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CCBL1 (KYAT1) (NM_001122671) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ16773)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

47.7 kDa

Amino Acid Sequence

MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFGYPPLTKILASFFGELLGQEIDPLRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRKMPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKVEL

Validation Images & Assay Conditions

There are currently no images for this product. We are working on uploading them please check back shortly or contact us to expedite our upload process for this antibody.

Gene/Protein Information For KYAT1 (Source: Uniprot.org, NCBI)

Gene Name

KYAT1

Full Name

Kynurenine--oxoglutarate transaminase 1

Weight

47.7 kDa

Superfamily

class-I pyridoxal-phosphate-dependent aminotransferase family

Alternative Names

Kynurenine--oxoglutarate transaminase 1 KYAT1 CCBL1, GTK, KAT1, KATI kynurenine aminotransferase 1 kynurenine--oxoglutarate transaminase 1|beta-lysase, kidney|cysteine conjugate beta lyase 1|cysteine conjugate-beta lyase, cytoplasmic|cysteine conjugate-beta lyase; cytoplasmic (glutamine transaminase K, kyneurenine aminotransferase)|cysteine-S-conjugate beta-lyase|glutamine transaminase K|glutamine--phenylpyruvate transaminase|glutamine-phenylpyruvate aminotransferase|kyneurenine aminotransferase|kynurenine aminotransferase I|kynurenine--oxoglutarate transaminase I

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on KYAT1, check out the KYAT1 Infographic

KYAT1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for KYAT1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ16773

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CCBL1 (KYAT1) (NM_001122671) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CCBL1 (KYAT1) (NM_001122671) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CCBL1 (KYAT1) (NM_001122671) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ16773
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.