Caspase 1 (CASP1) (NM_033294) Human Recombinant Protein

Caspase-1 protein,

Recombinant protein of human caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase) (CASP1), transcript variant delta

Product Info Summary

SKU: PROTP29466
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

Caspase 1 (CASP1) (NM_033294) Human Recombinant Protein

View all Caspase-1 recombinant proteins

SKU/Catalog Number

PROTP29466

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase) (CASP1), transcript variant delta

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Caspase 1 (CASP1) (NM_033294) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP29466)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

29.6 kDa

Amino Acid Sequence

MADKVLKEKRKLFIRSMGEAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH

Validation Images & Assay Conditions

Gene/Protein Information For CASP1 (Source: Uniprot.org, NCBI)

Gene Name

CASP1

Full Name

Caspase-1

Weight

29.6 kDa

Superfamily

peptidase C14A family

Alternative Names

CASP1; CASP-1; caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta; caspase 1, apoptosis-related cysteine protease (interleukin 1, beta; Caspase1; Caspase-1; EC 3.4.22; EC 3.4.22.36; ICE; ICEP45; IL-1 beta-converting enzyme; IL1BC CASP1 nirs variant 1; IL-1BC; IL1BCE; IL1B-convertase; interleukin 1-B converting enzyme; interleukin 1-beta convertase; Interleukin-1 beta convertase; Interleukin-1 beta-converting enzyme; p45 CASP1 ICE, IL1BC, P45 caspase 1 caspase-1|CASP1 nirs variant 1|IL-1 beta-converting enzyme|IL1B-convertase|caspase 1, apoptosis-related cysteine peptidase|caspase-1 isoform alpha|interleukin 1, beta, convertase|interleukin 1-B converting enzyme

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CASP1, check out the CASP1 Infographic

CASP1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CASP1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP29466

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Caspase 1 (CASP1) (NM_033294) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Caspase 1 (CASP1) (NM_033294) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Caspase 1 (CASP1) (NM_033294) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP29466
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.