Calcium binding protein P22 (CHP1) (NM_007236) Human Recombinant Protein

Calcium-binding-protein-P22 protein,

Product Info Summary

SKU: PROTQ99653
Size: 20 µg
Source: HEK293T

Product Name

Calcium binding protein P22 (CHP1) (NM_007236) Human Recombinant Protein

View all Calcium-binding-protein-P22 recombinant proteins

SKU/Catalog Number

PROTQ99653

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human calcium binding protein P22 (CHP)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Calcium binding protein P22 (CHP1) (NM_007236) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ99653)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

22.3 kDa

Amino Acid Sequence

MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLH

Validation Images & Assay Conditions

Gene/Protein Information For CHP1 (Source: Uniprot.org, NCBI)

Gene Name

CHP1

Full Name

Calcineurin B homologous protein 1

Weight

22.3 kDa

Superfamily

calcineurin regulatory subunit family

Alternative Names

Calcineurin B homolog; Calcineurin homologous protein; calcium binding protein P22; Calcium-binding protein CHP; calcium-binding protein p22; SLC9A1 binding protein; SLC9A1BP CHP1 CHP, SLC9A1BP, SPAX9, Sid470p, p22, p24 calcineurin like EF-hand protein 1 calcineurin B homologous protein 1|EF-hand calcium-binding domain-containing protein p22|SLC9A1 binding protein|calcineurin B homolog|calcineurin B-like protein|calcineurin homologous protein|calcium binding protein P22|calcium-binding protein CHP|calcium-binding protein p22

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CHP1, check out the CHP1 Infographic

CHP1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CHP1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ99653

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Calcium binding protein P22 (CHP1) (NM_007236) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Calcium binding protein P22 (CHP1) (NM_007236) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Calcium binding protein P22 (CHP1) (NM_007236) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ99653
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product