CA5B (NM_007220) Human Recombinant Protein

Carbonic Anhydrase VB/CA5B protein,

Recombinant protein of human carbonic anhydrase VB, mitochondrial (CA5B), nuclear gene encoding mitochondrial protein

Product Info Summary

SKU: PROTQ9Y2D0
Size: 20 µg
Source: HEK293T

Product Name

CA5B (NM_007220) Human Recombinant Protein

View all Carbonic Anhydrase VB/CA5B recombinant proteins

SKU/Catalog Number

PROTQ9Y2D0

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human carbonic anhydrase VB, mitochondrial (CA5B), nuclear gene encoding mitochondrial protein

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CA5B (NM_007220) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y2D0)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

32.5 kDa

Amino Acid Sequence

MVVMNSLRVILQASPGKLLWRKFQIPRFMPARPCSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATP

Validation Images & Assay Conditions

Gene/Protein Information For CA5B (Source: Uniprot.org, NCBI)

Gene Name

CA5B

Full Name

Carbonic anhydrase 5B, mitochondrial

Weight

32.5 kDa

Superfamily

alpha-carbonic anhydrase family

Alternative Names

CA5B; Carbonate dehydratase VB; carbonic anhydrase 5B, mitochondrial; Carbonic Anhydrase VB; carbonic anhydrase VB, mitochondrial; carbonic dehydratase; CAVB; CA-VB; EC 4.2.1.1; MGC39962 CA5B CA-VB, CAVB carbonic anhydrase 5B carbonic anhydrase 5B, mitochondrial|carbonate dehydratase VB|carbonic anhydrase VB, mitochondrial|carbonic dehydratase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CA5B, check out the CA5B Infographic

CA5B infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CA5B: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9Y2D0

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CA5B (NM_007220) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CA5B (NM_007220) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CA5B (NM_007220) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y2D0
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.