C9orf95 (NMRK1) (NM_017881) Human Recombinant Protein

NRK1 protein,

Product Info Summary

SKU: PROTQ9NWW6
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

C9orf95 (NMRK1) (NM_017881) Human Recombinant Protein

View all NRK1 recombinant proteins

SKU/Catalog Number

PROTQ9NWW6

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chromosome 9 open reading frame 95 (C9orf95), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

C9orf95 (NMRK1) (NM_017881) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NWW6)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

23 kDa

Amino Acid Sequence

MKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVSTDQESAEEIPILIIEGFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQVYEDLIQELAKQKCLQVTA

Validation Images & Assay Conditions

Gene/Protein Information For NMRK1 (Source: Uniprot.org, NCBI)

Gene Name

NMRK1

Full Name

Nicotinamide riboside kinase 1

Weight

23 kDa

Superfamily

uridine kinase family

Alternative Names

bA235O14.2; chromosome 9 open reading frame 95; EC 2.7.1.22; EC 2.7.1.n4; FLJ20559; nicotinamide riboside kinase 1; Nicotinic acid riboside kinase 1; NmR-K 1; NRK 1; NRK1; Ribosylnicotinamide kinase 1; Ribosylnicotinic acid kinase 1; RNK 1 NMRK1 C9orf95, NRK1, bA235O14.2 nicotinamide riboside kinase 1 nicotinamide riboside kinase 1|NRK 1|RNK 1|nicotinic acid riboside kinase 1|nmR-K 1|ribosylnicotinamide kinase 1|ribosylnicotinic acid kinase 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NMRK1, check out the NMRK1 Infographic

NMRK1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NMRK1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9NWW6

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used C9orf95 (NMRK1) (NM_017881) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For C9orf95 (NMRK1) (NM_017881) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for C9orf95 (NMRK1) (NM_017881) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NWW6
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.