C3orf37 (HMCES) (NM_001006109) Human Recombinant Protein

HMCES protein,

Recombinant protein of human chromosome 3 open reading frame 37 (C3orf37), transcript variant 1

Product Info Summary

SKU: PROTQ96FZ2
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

C3orf37 (HMCES) (NM_001006109) Human Recombinant Protein

View all HMCES recombinant proteins

SKU/Catalog Number

PROTQ96FZ2

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chromosome 3 open reading frame 37 (C3orf37), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

C3orf37 (HMCES) (NM_001006109) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96FZ2)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

40.4 kDa

Amino Acid Sequence

MCGRTSCHLPRDVLTRACAYQDRRGQQRLPEWRDPDKYCPSYNKSPQSNSPVLLSRLHFEKDADSSERIIAPMRWGLVPSWFKESDPSKLQFNTTNCRSDTVMEKRSFKVPLGKGRRCVVLADGFYEWQRCQGTNQRQPYFIYFPQIKTEKSGSIGAADSPENWEKVWDNWRLLTMAGIFDCWEPPEGGDVLYSYTIITVDSCKGLSDIHHRMPAILDGEEAVSKWLDFGEVSTQEALKLIHPTENITFHAVSSVVNNSRNNTPECLAPVDLVVKKELRASGSSQRMLQWLATKSPKKEDSKTPQKEESDVPQWSSQFLQKSPLPTKRGTAGLLEQWLKREKEEEPVAKRPYSQ

Validation Images & Assay Conditions

Gene/Protein Information For HMCES (Source: Uniprot.org, NCBI)

Gene Name

HMCES

Full Name

Abasic site processing protein HMCES

Weight

40.4 kDa

Superfamily

SOS response-associated peptidase family

Alternative Names

chromosome 3 open reading frame 37; DC12; MGC111075 HMCES C3orf37, DC12, SRAPD1 5-hydroxymethylcytosine binding, ES cell specific abasic site processing protein HMCES|5-hydroxymethylcytosine (hmC) binding, ES cell-specific|ES cell-specific 5hmC-binding protein|SOS response associated peptidase domain containing 1|SRAP domain-containing protein 1|UPF0361 protein C3orf37|embryonic stem cell-specific 5-hydroxymethylcytosine-binding protein|peptidase HMCES|putative endonuclease HMCES|putative peptidase SRAPD1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on HMCES, check out the HMCES Infographic

HMCES infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for HMCES: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96FZ2

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used C3orf37 (HMCES) (NM_001006109) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For C3orf37 (HMCES) (NM_001006109) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for C3orf37 (HMCES) (NM_001006109) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96FZ2
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product