C22orf40 (CDPF1) (NM_207327) Human Recombinant Protein

Cdpf1 protein,

Recombinant protein of human chromosome 22 open reading frame 40 (C22orf40)

Product Info Summary

SKU: PROTQ6NVV7
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

C22orf40 (CDPF1) (NM_207327) Human Recombinant Protein

View all Cdpf1 recombinant proteins

SKU/Catalog Number

PROTQ6NVV7

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chromosome 22 open reading frame 40 (C22orf40)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

C22orf40 (CDPF1) (NM_207327) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ6NVV7)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

13.7 kDa

Amino Acid Sequence

MASHVECRPLGVFECELCTLTAPYSYVGQKPPNTQSMVLLEESYVMKDPFTSDKDRFLVLGSCCSLCSRLVCVGPECSLFYSKRFCLPCVRENINAFPQEIRQDLEKRKAPSKRTPSQPGSRT

Validation Images & Assay Conditions

Gene/Protein Information For Cdpf1 (Source: Uniprot.org, NCBI)

Gene Name

Cdpf1

Full Name

Cysteine-rich DPF motif domain-containing protein 1

Weight

13.7 kDa

Superfamily

CDPF1 family

Alternative Names

C22orf40; chromosome 22 open reading frame 40; cysteine-rich, DPF motif domain containing 1; hypothetical protein LOC150383; LOC150383

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on Cdpf1, check out the Cdpf1 Infographic

Cdpf1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Cdpf1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ6NVV7

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used C22orf40 (CDPF1) (NM_207327) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For C22orf40 (CDPF1) (NM_207327) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for C22orf40 (CDPF1) (NM_207327) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ6NVV7
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.